Recombinant Human DUSP11 protein, His-tagged

• Cat.No.: DUSP11-3066H
• Product Overview: Recombinant Human DUSP11 protein(1-203 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-203 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICIYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DUSP11 dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [ Homo sapiens ]
• Official Symbol: DUSP11
• Synonyms: DUSP11; dual specificity phosphatase 11 (RNA/RNP complex 1-interacting); RNA/RNP complex-1-interacting phosphatase; PIR1; RNA/RNP complex-interacting phosphatase; dual specificity protein phosphatase 11; serine/threonine specific protein phosphatase; phosphatase that interacts with RNA/RNP complex 1
• Gene ID: 8446
• mRNA Refseq: NM_003584
• Protein Refseq: NP_003575
• MIM: 603092
• UniProt ID: O75319