Recombinant Human DUSP11 protein, His-tagged
Cat.No. : | DUSP11-3066H |
Product Overview : | Recombinant Human DUSP11 protein(1-203 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-203 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICIYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DUSP11 dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [ Homo sapiens ] |
Official Symbol | DUSP11 |
Synonyms | DUSP11; dual specificity phosphatase 11 (RNA/RNP complex 1-interacting); RNA/RNP complex-1-interacting phosphatase; PIR1; RNA/RNP complex-interacting phosphatase; dual specificity protein phosphatase 11; serine/threonine specific protein phosphatase; phosphatase that interacts with RNA/RNP complex 1; |
Gene ID | 8446 |
mRNA Refseq | NM_003584 |
Protein Refseq | NP_003575 |
MIM | 603092 |
UniProt ID | O75319 |
◆ Recombinant Proteins | ||
DUSP11-1631R | Recombinant Rat DUSP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP11-2923H | Recombinant Human DUSP11 Protein, GST-tagged | +Inquiry |
DUSP11-4090HF | Recombinant Full Length Human DUSP11 Protein, GST-tagged | +Inquiry |
DUSP11-4876M | Recombinant Mouse DUSP11 Protein | +Inquiry |
DUSP11-3066H | Recombinant Human DUSP11 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP11-6783HCL | Recombinant Human DUSP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP11 Products
Required fields are marked with *
My Review for All DUSP11 Products
Required fields are marked with *