Recombinant Human DUSP14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DUSP14-4928H |
Product Overview : | DUSP14 MS Standard C13 and N15-labeled recombinant protein (NP_008957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs. |
Molecular Mass : | 22.3 kDa |
AA Sequence : | MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DUSP14 dual specificity phosphatase 14 [ Homo sapiens (human) ] |
Official Symbol | DUSP14 |
Synonyms | DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L; |
Gene ID | 11072 |
mRNA Refseq | NM_007026 |
Protein Refseq | NP_008957 |
MIM | 606618 |
UniProt ID | O95147 |
◆ Recombinant Proteins | ||
DUSP14-2830H | Recombinant Human DUSP14 protein, His-SUMO-tagged | +Inquiry |
DUSP14-1349R | Recombinant Rhesus monkey DUSP14 Protein, His-tagged | +Inquiry |
Dusp14-2683M | Recombinant Mouse Dusp14 Protein, Myc/DDK-tagged | +Inquiry |
DUSP14-4097HF | Recombinant Full Length Human DUSP14 Protein, GST-tagged | +Inquiry |
DUSP14-1570Z | Recombinant Zebrafish DUSP14 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP14-6781HCL | Recombinant Human DUSP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP14 Products
Required fields are marked with *
My Review for All DUSP14 Products
Required fields are marked with *