Recombinant Human DUSP18 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DUSP18-3932H |
Product Overview : | DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DUSP18 dual specificity phosphatase 18 [ Homo sapiens (human) ] |
Official Symbol | DUSP18 |
Synonyms | DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658; |
Gene ID | 150290 |
mRNA Refseq | NM_152511 |
Protein Refseq | NP_689724 |
MIM | 611446 |
UniProt ID | Q8NEJ0 |
◆ Recombinant Proteins | ||
DUSP18-1175R | Recombinant Rhesus Macaque DUSP18 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP18-1633R | Recombinant Rat DUSP18 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP18-12210H | Recombinant Human DUSP18, GST-tagged | +Inquiry |
DUSP18-1350R | Recombinant Rhesus monkey DUSP18 Protein, His-tagged | +Inquiry |
DUSP18-1923H | Recombinant Human Dual Specificity Phosphatase 18, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP18-6780HCL | Recombinant Human DUSP18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP18 Products
Required fields are marked with *
My Review for All DUSP18 Products
Required fields are marked with *
0
Inquiry Basket