Recombinant Human DUSP18 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DUSP18-3932H
Product Overview : DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs.
Molecular Mass : 20.9 kDa
AA Sequence : MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DUSP18 dual specificity phosphatase 18 [ Homo sapiens (human) ]
Official Symbol DUSP18
Synonyms DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658;
Gene ID 150290
mRNA Refseq NM_152511
Protein Refseq NP_689724
MIM 611446
UniProt ID Q8NEJ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP18 Products

Required fields are marked with *

My Review for All DUSP18 Products

Required fields are marked with *

0
cart-icon
0
compare icon