Recombinant Human DUSP5 protein, His-tagged
Cat.No. : | DUSP5-7853H |
Product Overview : | Recombinant Human DUSP5 protein(311-384 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 311-384 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DUSP5 dual specificity phosphatase 5 [ Homo sapiens ] |
Official Symbol | DUSP5 |
Synonyms | DUSP5; dual specificity phosphatase 5; dual specificity protein phosphatase 5; HVH3; VH1-like phosphatase 3; dual specificity protein phosphatase hVH3; serine/threonine specific protein phosphatase; DUSP; |
Gene ID | 1847 |
mRNA Refseq | NM_004419 |
Protein Refseq | NP_004410 |
MIM | 603069 |
UniProt ID | Q16690 |
◆ Recombinant Proteins | ||
DUSP5-7854H | Recombinant Human DUSP5 protein, GST-tagged | +Inquiry |
DUSP5-382H | Recombinant Human DUSP5 Protein, His-tagged | +Inquiry |
DUSP5-1977R | Recombinant Rat DUSP5 Protein | +Inquiry |
DUSP5-7853H | Recombinant Human DUSP5 protein, His-tagged | +Inquiry |
DUSP5-11845Z | Recombinant Zebrafish DUSP5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP5 Products
Required fields are marked with *
My Review for All DUSP5 Products
Required fields are marked with *