Recombinant Human DNAL4 protein, His-tagged
| Cat.No. : | DNAL4-3532H |
| Product Overview : | Recombinant Human DNAL4 protein(1-105 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-105 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ] |
| Official Symbol | DNAL4 |
| Synonyms | DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27; dynein, axonemal, light 4; proliferation-inducing gene 27; dynein light chain, outer arm 4; proliferation-inducing protein 27; dynein, axonemal, light polypeptide 4; |
| Gene ID | 10126 |
| mRNA Refseq | NM_005740 |
| Protein Refseq | NP_005731 |
| MIM | 610565 |
| UniProt ID | O96015 |
| ◆ Recombinant Proteins | ||
| DNAL4-2772H | Recombinant Human DNAL4 Protein, GST-tagged | +Inquiry |
| DNAL4-1389C | Recombinant Chicken DNAL4 | +Inquiry |
| DNAL4-1303R | Recombinant Rhesus monkey DNAL4 Protein, His-tagged | +Inquiry |
| DNAL4-26062TH | Recombinant Human DNAL4, His-tagged | +Inquiry |
| DNAL4-4030HF | Recombinant Full Length Human DNAL4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAL4-6868HCL | Recombinant Human DNAL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAL4 Products
Required fields are marked with *
My Review for All DNAL4 Products
Required fields are marked with *



