Recombinant Human DYRK1A
| Cat.No. : | DYRK1A-26456TH |
| Product Overview : | Recombinant fragment of Human DYRK1A protein with an N terminal proprietary tag; predicted mwt: 35.53 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5 UTR or in the 3 coding region. These variants encode at least five different isoforms. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS |
| Gene Name | DYRK1A dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A [ Homo sapiens ] |
| Official Symbol | DYRK1A |
| Synonyms | DYRK1A; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; DYRK, DYRK1, MNBH; dual specificity tyrosine-phosphorylation-regulated kinase 1A; |
| Gene ID | 1859 |
| mRNA Refseq | NM_001396 |
| Protein Refseq | NP_001387 |
| MIM | 600855 |
| Uniprot ID | Q13627 |
| Chromosome Location | 21q22.13 |
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; G0 and Early G1, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Mitotic G1-G1/S phases, organism-specific biosystem; |
| Function | ATP binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| DYRK1A-2981H | Active Recombinant Human DYRK1A Protein, GST-tagged | +Inquiry |
| DYRK1A-2982H | Recombinant Human DYRK1A Protein, GST-tagged | +Inquiry |
| DYRK1A-19H | Recombinant Human DYRK1A, GST-tagged | +Inquiry |
| DYRK1A-1363R | Recombinant Rhesus monkey DYRK1A Protein, His-tagged | +Inquiry |
| DYRK1A-1188R | Recombinant Rhesus Macaque DYRK1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DYRK1A-6752HCL | Recombinant Human DYRK1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYRK1A Products
Required fields are marked with *
My Review for All DYRK1A Products
Required fields are marked with *
