Recombinant Human E2F7 Protein, GST-tagged

Cat.No. : E2F7-3010H
Product Overview : Human E2F7 partial ORF ( NP_976328.1, 801 a.a. - 910 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM, May 2008]
Molecular Mass : 37.84 kDa
AA Sequence : VVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name E2F7 E2F transcription factor 7 [ Homo sapiens ]
Official Symbol E2F7
Synonyms E2F7; E2F transcription factor 7; transcription factor E2F7; E2F-7; FLJ12981;
Gene ID 144455
mRNA Refseq NM_203394
Protein Refseq NP_976328
MIM 612046
UniProt ID Q96AV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E2F7 Products

Required fields are marked with *

My Review for All E2F7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon