Recombinant Human E2F7 Protein, GST-tagged
| Cat.No. : | E2F7-3010H |
| Product Overview : | Human E2F7 partial ORF ( NP_976328.1, 801 a.a. - 910 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM, May 2008] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | VVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | E2F7 E2F transcription factor 7 [ Homo sapiens ] |
| Official Symbol | E2F7 |
| Synonyms | E2F7; E2F transcription factor 7; transcription factor E2F7; E2F-7; FLJ12981; |
| Gene ID | 144455 |
| mRNA Refseq | NM_203394 |
| Protein Refseq | NP_976328 |
| MIM | 612046 |
| UniProt ID | Q96AV8 |
| ◆ Recombinant Proteins | ||
| E2F7-2600M | Recombinant Mouse E2F7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| E2F7-3010H | Recombinant Human E2F7 Protein, GST-tagged | +Inquiry |
| E2F7-4936M | Recombinant Mouse E2F7 Protein | +Inquiry |
| E2F7-4180Z | Recombinant Zebrafish E2F7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E2F7 Products
Required fields are marked with *
My Review for All E2F7 Products
Required fields are marked with *
