Recombinant Human EBF4 Protein, GST-tagged
Cat.No. : | EBF4-3023H |
Product Overview : | Human EBF4 full-length ORF ( AAH54347.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EBF4 early B-cell factor 4 [ Homo sapiens (human) ] |
Official Symbol | EBF4 |
Synonyms | EBF4; early B-cell factor 4; Early B-Cell Factor 4; Olf-1/EBF-Like 4; O/E-4; COE4; OE-4; Transcription Factor COE4; KIAA1442; EBF-4; transcription factor COE4; olf-1/EBF-like 4 |
Gene ID | 57593 |
mRNA Refseq | NM_001110514 |
Protein Refseq | NP_001103984 |
MIM | 609935 |
UniProt ID | Q9BQW3 |
◆ Recombinant Proteins | ||
Ebf4-2712M | Recombinant Mouse Ebf4 Protein, Myc/DDK-tagged | +Inquiry |
EBF4-3023H | Recombinant Human EBF4 Protein, GST-tagged | +Inquiry |
EBF4-4143HF | Recombinant Full Length Human EBF4 Protein, GST-tagged | +Inquiry |
EBF4-2537H | Recombinant Human EBF4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBF4-1537HCL | Recombinant Human EBF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBF4 Products
Required fields are marked with *
My Review for All EBF4 Products
Required fields are marked with *