Recombinant Human ECT2 Protein, GST-tagged
Cat.No. : | ECT2-3040H |
Product Overview : | Human ECT2 partial ORF (AAH06838.1, 46 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 46-145 a.a. |
Description : | The protein encoded by this gene is a guanine nucleotide exchange factor and transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of this gene is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ECT2 epithelial cell transforming sequence 2 oncogene [ Homo sapiens ] |
Official Symbol | ECT2 |
Synonyms | ECT2; epithelial cell transforming sequence 2 oncogene; protein ECT2; ARHGEF31; epithelial cell-transforming sequence 2 oncogene; FLJ10461; MGC138291; |
Gene ID | 1894 |
mRNA Refseq | NM_001258315 |
Protein Refseq | NP_001245244 |
MIM | 600586 |
UniProt ID | Q9H8V3 |
◆ Recombinant Proteins | ||
ECT2-2632M | Recombinant Mouse ECT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECT2-691H | Recombinant Human ECT2 Protein, His-tagged | +Inquiry |
Ect2-1661M | Recombinant Mouse Ect2 protein, His & GST-tagged | +Inquiry |
ECT2-3040H | Recombinant Human ECT2 Protein, GST-tagged | +Inquiry |
ECT2-4977M | Recombinant Mouse ECT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECT2-6728HCL | Recombinant Human ECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECT2 Products
Required fields are marked with *
My Review for All ECT2 Products
Required fields are marked with *
0
Inquiry Basket