Recombinant Full Length Human EDF1 Protein, GST-tagged

• Cat.No.: EDF1-4188HF
• Product Overview: Human EDF1 full-length ORF ( AAH15500.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 148 amino acids
• Description: This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Molecular Mass: 42.02 kDa
• AA Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ]
• Official Symbol: EDF1
• Synonyms: EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058
• Gene ID: 8721
• mRNA Refseq: NM_003792
• Protein Refseq: NP_003783
• MIM: 605107
• UniProt ID: O60869