Recombinant Human EDF1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : EDF1-108H
Product Overview : EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants.
Molecular Mass : 15.3 kDa
AA Sequence : MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGECPSTLRRVRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EDF1 endothelial differentiation related factor 1 [ Homo sapiens (human) ]
Official Symbol EDF1
Synonyms EDF1; endothelial differentiation related factor 1; CFAP280; EDF-1; MBF1; endothelial differentiation-related factor 1; multiprotein bridging factor 1
Gene ID 8721
mRNA Refseq NM_153200
Protein Refseq NP_694880
MIM 605107
UniProt ID O60869

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDF1 Products

Required fields are marked with *

My Review for All EDF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon