Recombinant Human EDF1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: EDF1-108H
• Product Overview: EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 15.3 kDa
• AA Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGECPSTLRRVRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EDF1 endothelial differentiation related factor 1 [ Homo sapiens (human) ]
• Official Symbol: EDF1
• Synonyms: EDF1; endothelial differentiation related factor 1; CFAP280; EDF-1; MBF1; endothelial differentiation-related factor 1; multiprotein bridging factor 1
• Gene ID: 8721
• mRNA Refseq: NM_153200
• Protein Refseq: NP_694880
• MIM: 605107
• UniProt ID: O60869