Recombinant Human EEA1 protein, GST-tagged

• Cat.No.: EEA1-301519H
• Product Overview: Recombinant Human EEA1 (1151-1350 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Lys1151-Ala1350
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EEA1 early endosome antigen 1 [ Homo sapiens ]
• Official Symbol: EEA1
• Synonyms: EEA1; early endosome antigen 1; early endosome antigen 1, 162kD; ZFYVE2; endosome-associated protein p162; early endosome-associated protein; zinc finger FYVE domain-containing protein 2; MST105; MSTP105
• Gene ID: 8411
• mRNA Refseq: NM_003566
• Protein Refseq: NP_003557
• MIM: 605070
• UniProt ID: Q15075