Recombinant Human EEA1 protein, His-tagged
Cat.No. : | EEA1-8789H |
Product Overview : | Recombinant Human EEA1 protein(1151-1350 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1151-1350 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | KLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | EEA1 early endosome antigen 1 [ Homo sapiens ] |
Official Symbol | EEA1 |
Synonyms | EEA1; early endosome antigen 1; early endosome antigen 1, 162kD; ZFYVE2; endosome-associated protein p162; early endosome-associated protein; zinc finger FYVE domain-containing protein 2; MST105; MSTP105; |
mRNA Refseq | NM_003566 |
Protein Refseq | NP_003557 |
MIM | 605070 |
UniProt ID | Q15075 |
Gene ID | 8411 |
◆ Recombinant Proteins | ||
Eea1-2731M | Recombinant Mouse Eea1 Protein, Myc/DDK-tagged | +Inquiry |
EEA1-3902H | Recombinant Human EEA1 protein, His-tagged | +Inquiry |
EEA1-9389HFL | Recombinant Full Length Human EEA1 protein, Flag-tagged | +Inquiry |
EEA1-301519H | Recombinant Human EEA1 protein, GST-tagged | +Inquiry |
EEA1-8789H | Recombinant Human EEA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEA1 Products
Required fields are marked with *
My Review for All EEA1 Products
Required fields are marked with *