Recombinant Human EEF1E1 protein, GST-tagged
Cat.No. : | EEF1E1-12292H |
Product Overview : | Recombinant Human EEF1E1 protein(1-174 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-174 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | EEF1E1 |
Synonyms | EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; |
Gene ID | 9521 |
mRNA Refseq | NM_001135650 |
Protein Refseq | NP_001129122 |
MIM | 609206 |
UniProt ID | O43324 |
◆ Recombinant Proteins | ||
EEF1E1-5002M | Recombinant Mouse EEF1E1 Protein | +Inquiry |
EEF1E1-27130TH | Recombinant Human EEF1E1, His-tagged | +Inquiry |
EEF1E1-12292H | Recombinant Human EEF1E1 protein, GST-tagged | +Inquiry |
EEF1E1-3510H | Recombinant Human EEF1E1 protein, His-tagged | +Inquiry |
EEF1E1-1384R | Recombinant Rhesus monkey EEF1E1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1E1-6713HCL | Recombinant Human EEF1E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1E1 Products
Required fields are marked with *
My Review for All EEF1E1 Products
Required fields are marked with *
0
Inquiry Basket