Recombinant Human EEF1E1 protein, GST-tagged
| Cat.No. : | EEF1E1-12292H |
| Product Overview : | Recombinant Human EEF1E1 protein(1-174 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 21, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-174 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | EEF1E1 |
| Synonyms | EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; |
| Gene ID | 9521 |
| mRNA Refseq | NM_001135650 |
| Protein Refseq | NP_001129122 |
| MIM | 609206 |
| UniProt ID | O43324 |
| ◆ Recombinant Proteins | ||
| EEF1E1-3510H | Recombinant Human EEF1E1 protein, His-tagged | +Inquiry |
| Eef1e1-1395M | Recombinant Mouse Eef1e1 protein, His & T7-tagged | +Inquiry |
| EEF1E1-2834H | Recombinant Human EEF1E1 protein, His-SUMO-tagged | +Inquiry |
| EEF1E1-2649M | Recombinant Mouse EEF1E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EEF1E1-1384R | Recombinant Rhesus monkey EEF1E1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1E1-6713HCL | Recombinant Human EEF1E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1E1 Products
Required fields are marked with *
My Review for All EEF1E1 Products
Required fields are marked with *




