Recombinant Human EEF1G protein, His-tagged
Cat.No. : | EEF1G-01H |
Product Overview : | Recombinant human EEF1G protein (1-437aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-437 a.a. |
Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
Form : | Liquid |
Molecular Mass : | 52.5 kDa (460aa) |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 10% glycerol, 1 mM DTT |
Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens (human) ] |
Official Symbol | EEF1G |
Synonyms | EEF1G; eukaryotic translation elongation factor 1 gamma; EF1G; GIG35; elongation factor 1-gamma; EF-1-gamma; PRO1608; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain |
Gene ID | 1937 |
mRNA Refseq | NM_001404 |
Protein Refseq | NP_001395 |
MIM | 130593 |
UniProt ID | Q53YD7 |
◆ Recombinant Proteins | ||
EEF1G-4783H | Recombinant Human EEF1G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EEF1G-9535Z | Recombinant Zebrafish EEF1G | +Inquiry |
EEF1G-1673R | Recombinant Rat EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1G-4210HF | Recombinant Full Length Human EEF1G Protein, GST-tagged | +Inquiry |
EEF1G-806H | Recombinant Human EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *