Recombinant Human EEF1G protein, His-tagged
| Cat.No. : | EEF1G-01H |
| Product Overview : | Recombinant human EEF1G protein (1-437aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-437 a.a. |
| Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
| Form : | Liquid |
| Molecular Mass : | 52.5 kDa (460aa) |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 10% glycerol, 1 mM DTT |
| Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens (human) ] |
| Official Symbol | EEF1G |
| Synonyms | EEF1G; eukaryotic translation elongation factor 1 gamma; EF1G; GIG35; elongation factor 1-gamma; EF-1-gamma; PRO1608; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain |
| Gene ID | 1937 |
| mRNA Refseq | NM_001404 |
| Protein Refseq | NP_001395 |
| MIM | 130593 |
| UniProt ID | Q53YD7 |
| ◆ Recombinant Proteins | ||
| EEF1G-3074H | Recombinant Human EEF1G Protein, GST-tagged | +Inquiry |
| EEF1G-4222C | Recombinant Chicken EEF1G | +Inquiry |
| EEF1G-1210R | Recombinant Rhesus Macaque EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
| EEF1G-01H | Recombinant Human EEF1G protein, His-tagged | +Inquiry |
| EEF1G-4783H | Recombinant Human EEF1G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *
