Recombinant Human EEF1G Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EEF1G-4783H
Product Overview : EEF1G MS Standard C13 and N15-labeled recombinant protein (NP_001395) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
Molecular Mass : 49.9 kDa
AA Sequence : MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens (human) ]
Official Symbol EEF1G
Synonyms EEF1G; eukaryotic translation elongation factor 1 gamma; elongation factor 1-gamma; EF1G; PRO1608; EF-1-gamma; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain; GIG35;
Gene ID 1937
mRNA Refseq NM_001404
Protein Refseq NP_001395
MIM 130593
UniProt ID P26641

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEF1G Products

Required fields are marked with *

My Review for All EEF1G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon