Recombinant Human EEF1G Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EEF1G-4783H |
Product Overview : | EEF1G MS Standard C13 and N15-labeled recombinant protein (NP_001395) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens (human) ] |
Official Symbol | EEF1G |
Synonyms | EEF1G; eukaryotic translation elongation factor 1 gamma; elongation factor 1-gamma; EF1G; PRO1608; EF-1-gamma; eEF-1B gamma; pancreatic tumor-related protein; translation elongation factor eEF-1 gamma chain; GIG35; |
Gene ID | 1937 |
mRNA Refseq | NM_001404 |
Protein Refseq | NP_001395 |
MIM | 130593 |
UniProt ID | P26641 |
◆ Recombinant Proteins | ||
EEF1G-4222C | Recombinant Chicken EEF1G | +Inquiry |
EEF1G-1385R | Recombinant Rhesus monkey EEF1G Protein, His-tagged | +Inquiry |
EEF1G-01H | Recombinant Human EEF1G protein, His-tagged | +Inquiry |
EEF1G-806H | Recombinant Human EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
Eef1g-2738M | Recombinant Mouse Eef1g Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *