Recombinant Human EFHC1 protein, His-tagged
| Cat.No. : | EFHC1-3887H |
| Product Overview : | Recombinant Human EFHC1 protein(291-640 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-640 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | LMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKINYYNFVRAFSN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | EFHC1 EF-hand domain (C-terminal) containing 1 [ Homo sapiens ] |
| Official Symbol | EFHC1 |
| Synonyms | EFHC1; EF-hand domain (C-terminal) containing 1; EF-hand domain-containing protein 1; myoclonin-1; dJ304B14.2; FLJ10466; FLJ37290; |
| Gene ID | 114327 |
| mRNA Refseq | NM_001172420 |
| Protein Refseq | NP_001165891 |
| MIM | 608815 |
| UniProt ID | Q5JVL4 |
| ◆ Recombinant Proteins | ||
| EFHC1-4211HF | Recombinant Full Length Human EFHC1 Protein, GST-tagged | +Inquiry |
| EFHC1-1389R | Recombinant Rhesus monkey EFHC1 Protein, His-tagged | +Inquiry |
| EFHC1-1729HFL | Recombinant Full Length Human EFHC1 Protein, C-Flag-tagged | +Inquiry |
| EFHC1-3887H | Recombinant Human EFHC1 protein, His-tagged | +Inquiry |
| EFHC1-1731H | Recombinant Human EFHC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFHC1-6701HCL | Recombinant Human EFHC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHC1 Products
Required fields are marked with *
My Review for All EFHC1 Products
Required fields are marked with *
