Recombinant Human EFHC1 protein, His-tagged
Cat.No. : | EFHC1-3887H |
Product Overview : | Recombinant Human EFHC1 protein(291-640 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 291-640 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKINYYNFVRAFSN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EFHC1 EF-hand domain (C-terminal) containing 1 [ Homo sapiens ] |
Official Symbol | EFHC1 |
Synonyms | EFHC1; EF-hand domain (C-terminal) containing 1; EF-hand domain-containing protein 1; myoclonin-1; dJ304B14.2; FLJ10466; FLJ37290; |
Gene ID | 114327 |
mRNA Refseq | NM_001172420 |
Protein Refseq | NP_001165891 |
MIM | 608815 |
UniProt ID | Q5JVL4 |
◆ Recombinant Proteins | ||
EFHC1-3090H | Recombinant Human EFHC1 Protein, GST-tagged | +Inquiry |
EFHC1-1731H | Recombinant Human EFHC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EFHC1-3887H | Recombinant Human EFHC1 protein, His-tagged | +Inquiry |
EFHC1-1729HFL | Recombinant Full Length Human EFHC1 Protein, C-Flag-tagged | +Inquiry |
EFHC1-12307H | Recombinant Human EFHC1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFHC1-6701HCL | Recombinant Human EFHC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHC1 Products
Required fields are marked with *
My Review for All EFHC1 Products
Required fields are marked with *