Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EFHD2-5430H |
| Product Overview : | EFHD2 MS Standard C13 and N15-labeled recombinant protein (NP_077305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. Diseases associated with EFHD2 include Motion Sickness. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1. |
| Molecular Mass : | 26.7 kDa |
| AA Sequence : | MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EFHD2 EF-hand domain family member D2 [ Homo sapiens (human) ] |
| Official Symbol | EFHD2 |
| Synonyms | EFHD2; EF-hand domain family member D2; SWS1; EF-hand domain-containing protein D2; EF hand domain containing 2; swiprosin 1; testicular tissue protein Li 62 |
| Gene ID | 79180 |
| mRNA Refseq | NM_024329 |
| Protein Refseq | NP_077305 |
| MIM | 616450 |
| UniProt ID | Q96C19 |
| ◆ Recombinant Proteins | ||
| EFHD2-1680R | Recombinant Rat EFHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EFHD2-1384H | Recombinant Human EFHD2 Protein, MYC/DDK-tagged | +Inquiry |
| EFHD2-1216R | Recombinant Rhesus Macaque EFHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EFHD2-5430H | Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EFHD2-2142M | Recombinant Mouse EFHD2 Protein (2-240 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHD2 Products
Required fields are marked with *
My Review for All EFHD2 Products
Required fields are marked with *
