Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EFHD2-5430H
Product Overview : EFHD2 MS Standard C13 and N15-labeled recombinant protein (NP_077305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. Diseases associated with EFHD2 include Motion Sickness. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1.
Molecular Mass : 26.7 kDa
AA Sequence : MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EFHD2 EF-hand domain family member D2 [ Homo sapiens (human) ]
Official Symbol EFHD2
Synonyms EFHD2; EF-hand domain family member D2; SWS1; EF-hand domain-containing protein D2; EF hand domain containing 2; swiprosin 1; testicular tissue protein Li 62
Gene ID 79180
mRNA Refseq NM_024329
Protein Refseq NP_077305
MIM 616450
UniProt ID Q96C19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFHD2 Products

Required fields are marked with *

My Review for All EFHD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon