Recombinant Human EFNA1, His-tagged

• Cat.No.: EFNA1-28470TH
• Product Overview: Recombinant full length Human Ephrin A1 with an N terminal His tag; 185 amino acids with tag, Predicted MWt 21.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 164 amino acids
• Description: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.
• Conjugation: HIS
• Molecular Weight: 21.600kDa inclusive of tags
• Tissue specificity: Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 2.4% Urea
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS
• Sequence Similarities: Belongs to the ephrin family.

Gene Information

• Gene Name: EFNA1 ephrin-A1 [ Homo sapiens ]
• Official Symbol: EFNA1
• Synonyms: EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1
• Gene ID: 1942
• mRNA Refseq: NM_182685
• Protein Refseq: NP_872626
• MIM: 191164
• Uniprot ID: P20827
• Chromosome Location: 1q21-q22
• Pathway: Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EPHA2 forward signaling, organism-specific biosystem
• Function: ephrin receptor binding; protein binding; receptor binding