Recombinant Human EFNA2 Protein, GST-tagged
Cat.No. : | EFNA2-3098H |
Product Overview : | Human EFNA2 full-length ORF ( AAI48728.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.38 kDa |
AA Sequence : | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFNA2 ephrin-A2 [ Homo sapiens ] |
Official Symbol | EFNA2 |
Synonyms | EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6; HEK7 ligand; eph-related receptor tyrosine kinase ligand 6; ELF-1; HEK7-L; LERK-6; |
Gene ID | 1943 |
mRNA Refseq | NM_001405 |
Protein Refseq | NP_001396 |
MIM | 602756 |
UniProt ID | O43921 |
◆ Recombinant Proteins | ||
Efna2-2669M | Recombinant Mouse Efna2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFNA2-1381H | Recombinant Human EFNA2 Protein, MYC/DDK-tagged | +Inquiry |
EFNA2-52H | Recombinant Human EFNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efna2-431M | Active Recombinant Mouse Ephrin A2, His-tagged | +Inquiry |
Efna2-4048M | Recombinant Mouse Efna2 protein(Met1-Asn184) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA2-2004MCL | Recombinant Mouse EFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA2 Products
Required fields are marked with *
My Review for All EFNA2 Products
Required fields are marked with *
0
Inquiry Basket