"EGFR" Related Products

Expand
Expand

Recombinant Human EGFR protein, Fc-tagged

Cat.No.: EGFR-629H
Product Overview: Recombinant Human EGFR(Leu25-Ser378) fused with Fc tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Human
Tag: Fc
Form: Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4
Protein length: Leu25-Ser378
AA Sequence: LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: EGFR epidermal growth factor receptor [ Homo sapiens ]
Official Symbol: EGFR
Synonyms: EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61;
Gene ID: 1956
mRNA Refseq: NM_201283
Protein Refseq: NP_958440
MIM: 131550
UniProt ID: P00533
Chromosome Location: 7p12
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem;
Function: ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.