Recombinant Human EGLN2 protein, His-tagged
Cat.No. : | EGLN2-2840H |
Product Overview : | Recombinant Human EGLN2 protein(Q96KS0)(283-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 283-407aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EGLN2 egl nine homolog 2 (C. elegans) [ Homo sapiens ] |
Official Symbol | EGLN2 |
Synonyms | EGLN2; egl nine homolog 2 (C. elegans); EGL nine (C.elegans) homolog 2; egl nine homolog 2; HIF prolyl hydroxylase 1; HIFPH1; PHD1; estrogen-induced tag 6; HIF-prolyl hydroxylase 1; hypoxia-inducible factor prolyl hydroxylase 1; prolyl hydroxylase domain-containing protein 1; EIT6; HPH-1; HPH-3; HIF-PH1; FLJ95603; DKFZp434E026; |
Gene ID | 112398 |
mRNA Refseq | NM_053046 |
Protein Refseq | NP_444274 |
MIM | 606424 |
UniProt ID | Q96KS0 |
◆ Recombinant Proteins | ||
EGLN2-3118H | Recombinant Human EGLN2 Protein, GST-tagged | +Inquiry |
EGLN2-4013H | Recombinant Human EGLN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EGLN2-2840H | Recombinant Human EGLN2 protein, His-tagged | +Inquiry |
EGLN2-811H | Recombinant Human EGLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN2-174HFL | Active Recombinant Full Length Human EGLN2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN2-6694HCL | Recombinant Human EGLN2 293 Cell Lysate | +Inquiry |
EGLN2-6695HCL | Recombinant Human EGLN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLN2 Products
Required fields are marked with *
My Review for All EGLN2 Products
Required fields are marked with *