Recombinant Human EGLN2 protein, His-tagged

Cat.No. : EGLN2-2840H
Product Overview : Recombinant Human EGLN2 protein(Q96KS0)(283-407aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 283-407aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.1 kDa
AA Sequence : MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name EGLN2 egl nine homolog 2 (C. elegans) [ Homo sapiens ]
Official Symbol EGLN2
Synonyms EGLN2; egl nine homolog 2 (C. elegans); EGL nine (C.elegans) homolog 2; egl nine homolog 2; HIF prolyl hydroxylase 1; HIFPH1; PHD1; estrogen-induced tag 6; HIF-prolyl hydroxylase 1; hypoxia-inducible factor prolyl hydroxylase 1; prolyl hydroxylase domain-containing protein 1; EIT6; HPH-1; HPH-3; HIF-PH1; FLJ95603; DKFZp434E026;
Gene ID 112398
mRNA Refseq NM_053046
Protein Refseq NP_444274
MIM 606424
UniProt ID Q96KS0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGLN2 Products

Required fields are marked with *

My Review for All EGLN2 Products

Required fields are marked with *

0
cart-icon