Recombinant Human EGLN3 protein, GST-tagged
Cat.No. : | EGLN3-1844H |
Product Overview : | Recombinant Human EGLN3 protein, fused to GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EGLN3 egl nine homolog 3 (C. elegans) [ Homo sapiens ] |
Official Symbol | EGLN3 |
Synonyms | EGLN3; egl nine homolog 3 (C. elegans); EGL nine (C.elegans) homolog 3; egl nine homolog 3; HIF prolyl hydroxylase 3; HIFPH3; PHD3; HPH-1; HPH-3; HIF-PH3; HIF-prolyl hydroxylase 3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3; FLJ21620; MGC125998; MGC125999; |
Gene ID | 112399 |
mRNA Refseq | NM_022073 |
Protein Refseq | NP_071356 |
MIM | 606426 |
UniProt ID | Q9H6Z9 |
◆ Recombinant Proteins | ||
EGLN3-3119H | Recombinant Human EGLN3 Protein, GST-tagged | +Inquiry |
EGLN3-400H | Recombinant Human EGLN3 Protein, MYC/DDK-tagged | +Inquiry |
EGLN3-2031R | Recombinant Rat EGLN3 Protein | +Inquiry |
EGLN3-4262HF | Recombinant Full Length Human EGLN3 Protein, GST-tagged | +Inquiry |
EGLN3-1328H | Recombinant Human EGLN3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN3-6693HCL | Recombinant Human EGLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLN3 Products
Required fields are marked with *
My Review for All EGLN3 Products
Required fields are marked with *