Recombinant Human EGR1 protein, His-B2M-tagged
Cat.No. : | EGR1-2841H |
Product Overview : | Recombinant Human EGR1 protein(P18146)(444-543aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 444-543aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.1 kDa |
AA Sequence : | SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EGR1 early growth response 1 [ Homo sapiens ] |
Official Symbol | EGR1 |
Synonyms | EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225; EGR-1; transcription factor Zif268; zinc finger protein Krox-24; nerve growth factor-induced protein A; NGFI-A; KROX-24; ZIF-268; |
Gene ID | 1958 |
mRNA Refseq | NM_001964 |
Protein Refseq | NP_001955 |
MIM | 128990 |
UniProt ID | P18146 |
◆ Recombinant Proteins | ||
EGR1-8845Z | Recombinant Zebrafish EGR1 | +Inquiry |
EGR1-52 | Recombinant Human EGR1 protein, His-tagged | +Inquiry |
EGR1-628H | Recombinant Human EGR1 Protein, His-tagged | +Inquiry |
EGR1-1384H | Recombinant Human EGR1 Protein (444-543 aa), His-tagged | +Inquiry |
EGR1-2841H | Recombinant Human EGR1 protein, His-B2M-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGR1-6692HCL | Recombinant Human EGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGR1 Products
Required fields are marked with *
My Review for All EGR1 Products
Required fields are marked with *