Recombinant Human EHMT1, His-tagged
Cat.No. : | EHMT1-27743TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 460-716 a.a. |
Description : | The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 103 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SAAQEAQEDGLPDTSSAAAADPL |
Gene Name | EHMT1 euchromatic histone-lysine N-methyltransferase 1 [ Homo sapiens ] |
Official Symbol | EHMT1 |
Synonyms | EHMT1; euchromatic histone-lysine N-methyltransferase 1; euchromatic histone methyltransferase 1; histone-lysine N-methyltransferase EHMT1; bA188C12.1; Eu HMTase1; FLJ12879; KIAA1876; KMT1D; |
Gene ID | 79813 |
mRNA Refseq | NM_024757 |
Protein Refseq | NP_079033 |
MIM | 607001 |
Uniprot ID | Q9H9B1 |
Chromosome Location | 9 |
Pathway | Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; |
Function | histone methyltransferase activity (H3-K27 specific); histone methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; metal ion binding; methyltransferase activity; |
◆ Recombinant Proteins | ||
EHMT1-27743TH | Recombinant Human EHMT1, His-tagged | +Inquiry |
EHMT1-006H | Recombinant Human EHMT1 Protein, GST-tagged | +Inquiry |
EHMT1-5063M | Recombinant Mouse EHMT1 Protein | +Inquiry |
EHMT1-2689M | Recombinant Mouse EHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHMT1-3136H | Recombinant Human EHMT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EHMT1-6685HCL | Recombinant Human EHMT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EHMT1 Products
Required fields are marked with *
My Review for All EHMT1 Products
Required fields are marked with *
0
Inquiry Basket