Recombinant Human EHMT1, His-tagged

Cat.No. : EHMT1-27743TH
Product Overview : Recombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 460-716 a.a.
Description : The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 103 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SAAQEAQEDGLPDTSSAAAADPL
Gene Name EHMT1 euchromatic histone-lysine N-methyltransferase 1 [ Homo sapiens ]
Official Symbol EHMT1
Synonyms EHMT1; euchromatic histone-lysine N-methyltransferase 1; euchromatic histone methyltransferase 1; histone-lysine N-methyltransferase EHMT1; bA188C12.1; Eu HMTase1; FLJ12879; KIAA1876; KMT1D;
Gene ID 79813
mRNA Refseq NM_024757
Protein Refseq NP_079033
MIM 607001
Uniprot ID Q9H9B1
Chromosome Location 9
Pathway Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem;
Function histone methyltransferase activity (H3-K27 specific); histone methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; metal ion binding; methyltransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EHMT1 Products

Required fields are marked with *

My Review for All EHMT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon