Recombinant Human EIF1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EIF1B-3035H
Product Overview : EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probably involved in translation.
Molecular Mass : 12.8 kDa
AA Sequence : MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens (human) ]
Official Symbol EIF1B
Synonyms EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20;
Gene ID 10289
mRNA Refseq NM_005875
Protein Refseq NP_005866
UniProt ID O60739

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR15 Products

Required fields are marked with *

My Review for All GPR15 Products

Required fields are marked with *

0
cart-icon