Recombinant Human EIF1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EIF1B-3035H |
Product Overview : | EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Probably involved in translation. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens (human) ] |
Official Symbol | EIF1B |
Synonyms | EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20; |
Gene ID | 10289 |
mRNA Refseq | NM_005875 |
Protein Refseq | NP_005866 |
UniProt ID | O60739 |
◆ Recombinant Proteins | ||
EIF1B-1677H | Recombinant Human EIF1B Protein (Met1-Phe113), N-His tagged | +Inquiry |
RFL4156MF | Recombinant Full Length Mouse G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
GPR15-5192H | Recombinant Human GPR15 Protein, GST-tagged | +Inquiry |
GPR15-1764R | Recombinant Rhesus Macaque GPR15 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1B-1413R | Recombinant Rhesus monkey EIF1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
0
Inquiry Basket