Recombinant Human EIF1B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EIF1B-3035H |
| Product Overview : | EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Probably involved in translation. |
| Molecular Mass : | 12.8 kDa |
| AA Sequence : | MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens (human) ] |
| Official Symbol | EIF1B |
| Synonyms | EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20; |
| Gene ID | 10289 |
| mRNA Refseq | NM_005875 |
| Protein Refseq | NP_005866 |
| UniProt ID | O60739 |
| ◆ Recombinant Proteins | ||
| RFL27731PF | Recombinant Full Length Pan Troglodytes G-Protein Coupled Receptor 15(Gpr15) Protein, His-Tagged | +Inquiry |
| GPR15-5191H | Recombinant Human GPR15 Protein | +Inquiry |
| EIF1B-5073M | Recombinant Mouse EIF1B Protein | +Inquiry |
| EIF1B-483C | Recombinant Cynomolgus EIF1B Protein, His-tagged | +Inquiry |
| EIF1B-3480H | Recombinant Human EIF1B, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF1B-244HCL | Recombinant Human EIF1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR15 Products
Required fields are marked with *
My Review for All GPR15 Products
Required fields are marked with *
