Recombinant Human EIF2AK2 Protein, GST-tagged
| Cat.No. : | EIF2AK2-3149H |
| Product Overview : | Human EIF2AK2 partial ORF ( NP_002750, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF2AK2 eukaryotic translation initiation factor 2-alpha kinase 2 [ Homo sapiens ] |
| Official Symbol | EIF2AK2 |
| Synonyms | EIF2AK2; eukaryotic translation initiation factor 2-alpha kinase 2; PRKR, protein kinase, interferon inducible double stranded RNA dependent; interferon-induced, double-stranded RNA-activated protein kinase; EIF2AK1; PKR; p68 kinase; eIF-2A protein kinase 2; P1/eIF-2A protein kinase; tyrosine-protein kinase EIF2AK2; interferon-inducible elF2alpha kinase; double stranded RNA activated protein kinase; protein kinase, interferon-inducible double stranded RNA dependent; PRKR; MGC126524; |
| Gene ID | 5610 |
| mRNA Refseq | NM_001135651 |
| Protein Refseq | NP_001129123 |
| MIM | 176871 |
| UniProt ID | P19525 |
| ◆ Recombinant Proteins | ||
| Eif2ak2-2771M | Recombinant Mouse Eif2ak2 Protein, Myc/DDK-tagged | +Inquiry |
| EIF2AK2-6421Z | Recombinant Zebrafish EIF2AK2 | +Inquiry |
| EIF2AK2-12350H | Recombinant Human EIF2AK2, His-tagged | +Inquiry |
| EIF2AK2-2163H | Recombinant Human EIF2AK2 Protein (Ser224-Ile502), N-His tagged | +Inquiry |
| EIF2AK2-2699M | Recombinant Mouse EIF2AK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2AK2-152HKCL | Human EIF2AK2 Knockdown Cell Lysate | +Inquiry |
| EIF2AK2-6674HCL | Recombinant Human EIF2AK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2AK2 Products
Required fields are marked with *
My Review for All EIF2AK2 Products
Required fields are marked with *



