Recombinant Human EIF2AK2 Protein, GST-tagged

Cat.No. : EIF2AK2-3149H
Product Overview : Human EIF2AK2 partial ORF ( NP_002750, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 36.74 kDa
AA Sequence : MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2AK2 eukaryotic translation initiation factor 2-alpha kinase 2 [ Homo sapiens ]
Official Symbol EIF2AK2
Synonyms EIF2AK2; eukaryotic translation initiation factor 2-alpha kinase 2; PRKR, protein kinase, interferon inducible double stranded RNA dependent; interferon-induced, double-stranded RNA-activated protein kinase; EIF2AK1; PKR; p68 kinase; eIF-2A protein kinase 2; P1/eIF-2A protein kinase; tyrosine-protein kinase EIF2AK2; interferon-inducible elF2alpha kinase; double stranded RNA activated protein kinase; protein kinase, interferon-inducible double stranded RNA dependent; PRKR; MGC126524;
Gene ID 5610
mRNA Refseq NM_001135651
Protein Refseq NP_001129123
MIM 176871
UniProt ID P19525

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2AK2 Products

Required fields are marked with *

My Review for All EIF2AK2 Products

Required fields are marked with *

0
cart-icon
0
compare icon