Recombinant Human EIF2AK4

Cat.No. : EIF2AK4-28160TH
Product Overview : Recombinant fragment of Human GCN2 with proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Widely expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
Sequence Similarities : Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.Contains 2 protein kinase domains.Contains 1 RWD domain.
Gene Name EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ]
Official Symbol EIF2AK4
Synonyms EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338;
Gene ID 440275
mRNA Refseq NM_001013703
Protein Refseq NP_001013725
MIM 609280
Uniprot ID Q9P2K8
Chromosome Location 15q13.3
Pathway Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem;
Function ATP binding; aminoacyl-tRNA ligase activity; eukaryotic translation initiation factor 2alpha kinase activity; nucleotide binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2AK4 Products

Required fields are marked with *

My Review for All EIF2AK4 Products

Required fields are marked with *

0
cart-icon
0
compare icon