Recombinant Human EIF2AK4
Cat.No. : | EIF2AK4-28160TH |
Product Overview : | Recombinant fragment of Human GCN2 with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF |
Sequence Similarities : | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.Contains 2 protein kinase domains.Contains 1 RWD domain. |
Gene Name | EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ] |
Official Symbol | EIF2AK4 |
Synonyms | EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; |
Gene ID | 440275 |
mRNA Refseq | NM_001013703 |
Protein Refseq | NP_001013725 |
MIM | 609280 |
Uniprot ID | Q9P2K8 |
Chromosome Location | 15q13.3 |
Pathway | Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem; |
Function | ATP binding; aminoacyl-tRNA ligase activity; eukaryotic translation initiation factor 2alpha kinase activity; nucleotide binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
EIF2AK4-3346H | Recombinant Human EIF2AK4 protein, His-tagged | +Inquiry |
EIF2AK4-2310HF | Active Recombinant Full Length Human EIF2AK4 Protein, DDK-tagged, Biotinylated | +Inquiry |
EIF2AK4-3152H | Active Recombinant Human EIF2AK4 Protein, GST-tagged | +Inquiry |
EIF2AK4-28160TH | Recombinant Human EIF2AK4 | +Inquiry |
EIF2AK4-3747HF | Active Recombinant Full Length Human EIF2AK4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2AK4-6672HCL | Recombinant Human EIF2AK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2AK4 Products
Required fields are marked with *
My Review for All EIF2AK4 Products
Required fields are marked with *
0
Inquiry Basket