Recombinant Human EIF2AK4
| Cat.No. : | EIF2AK4-28160TH |
| Product Overview : | Recombinant fragment of Human GCN2 with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Widely expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF |
| Sequence Similarities : | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.Contains 2 protein kinase domains.Contains 1 RWD domain. |
| Gene Name | EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ] |
| Official Symbol | EIF2AK4 |
| Synonyms | EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; |
| Gene ID | 440275 |
| mRNA Refseq | NM_001013703 |
| Protein Refseq | NP_001013725 |
| MIM | 609280 |
| Uniprot ID | Q9P2K8 |
| Chromosome Location | 15q13.3 |
| Pathway | Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem; |
| Function | ATP binding; aminoacyl-tRNA ligase activity; eukaryotic translation initiation factor 2alpha kinase activity; nucleotide binding; protein homodimerization activity; |
| ◆ Recombinant Proteins | ||
| EIF2AK4-3153H | Recombinant Human EIF2AK4 Protein, GST-tagged | +Inquiry |
| EIF2AK4-1414H | Recombinant Human EIF2AK4 Protein, His-tagged | +Inquiry |
| EIF2AK4-4488HF | Recombinant Full Length Human EIF2AK4 Protein, GST-tagged | +Inquiry |
| EIF2AK4-5078M | Recombinant Mouse EIF2AK4 Protein | +Inquiry |
| EIF2AK4-3346H | Recombinant Human EIF2AK4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2AK4-342HKCL | Human EIF2AK4 Knockdown Cell Lysate | +Inquiry |
| EIF2AK4-6672HCL | Recombinant Human EIF2AK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2AK4 Products
Required fields are marked with *
My Review for All EIF2AK4 Products
Required fields are marked with *



