Recombinant Human EIF2AK4 protein, GST-tagged
| Cat.No. : | EIF2AK4-7854H |
| Product Overview : | Recombinant Human EIF2AK4 protein(875-1080 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 875-1080 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | AFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | EIF2AK4 |
| Synonyms | EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; GCN2-like protein; GCN2 eIF2alpha kinase; |
| Gene ID | 440275 |
| mRNA Refseq | NM_001013703 |
| Protein Refseq | NP_001013725 |
| MIM | 609280 |
| UniProt ID | Q9P2K8 |
| ◆ Recombinant Proteins | ||
| EIF2AK4-3346H | Recombinant Human EIF2AK4 protein, His-tagged | +Inquiry |
| EIF2AK4-4488HF | Recombinant Full Length Human EIF2AK4 Protein, GST-tagged | +Inquiry |
| EIF2AK4-5078M | Recombinant Mouse EIF2AK4 Protein | +Inquiry |
| EIF2AK4-7854H | Recombinant Human EIF2AK4 protein, GST-tagged | +Inquiry |
| EIF2AK4-2700M | Recombinant Mouse EIF2AK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2AK4-6672HCL | Recombinant Human EIF2AK4 293 Cell Lysate | +Inquiry |
| EIF2AK4-342HKCL | Human EIF2AK4 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2AK4 Products
Required fields are marked with *
My Review for All EIF2AK4 Products
Required fields are marked with *
