Recombinant Human EIF2AK4 protein, GST-tagged

• Cat.No.: EIF2AK4-7854H
• Product Overview: Recombinant Human EIF2AK4 protein(875-1080 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 875-1080 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: AFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: EIF2AK4
• Synonyms: EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; GCN2-like protein; GCN2 eIF2alpha kinase
• Gene ID: 440275
• mRNA Refseq: NM_001013703
• Protein Refseq: NP_001013725
• MIM: 609280
• UniProt ID: Q9P2K8