Recombinant Human EIF2S2 protein(91-230 aa), C-His-tagged

Cat.No. : EIF2S2-2687H
Product Overview : Recombinant Human EIF2S2 protein(P20042)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-230 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : IDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLH
Gene Name EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ]
Official Symbol EIF2S2
Synonyms EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198;
Gene ID 8894
mRNA Refseq NM_003908
Protein Refseq NP_003899
MIM 603908
UniProt ID P20042

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2S2 Products

Required fields are marked with *

My Review for All EIF2S2 Products

Required fields are marked with *

0
cart-icon