Recombinant Human EIF2S2 protein(91-230 aa), C-His-tagged

• Cat.No.: EIF2S2-2687H
• Product Overview: Recombinant Human EIF2S2 protein(P20042)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: IDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLH

Gene Information

• Gene Name: EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ]
• Official Symbol: EIF2S2
• Synonyms: EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198
• Gene ID: 8894
• mRNA Refseq: NM_003908
• Protein Refseq: NP_003899
• MIM: 603908
• UniProt ID: P20042