Recombinant Human EIF2S2 protein(91-230 aa), C-His-tagged
Cat.No. : | EIF2S2-2687H |
Product Overview : | Recombinant Human EIF2S2 protein(P20042)(91-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-230 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | IDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLH |
Gene Name | EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ] |
Official Symbol | EIF2S2 |
Synonyms | EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198; |
Gene ID | 8894 |
mRNA Refseq | NM_003908 |
Protein Refseq | NP_003899 |
MIM | 603908 |
UniProt ID | P20042 |
◆ Recombinant Proteins | ||
Eif2s2-2776M | Recombinant Mouse Eif2s2 Protein, Myc/DDK-tagged | +Inquiry |
EIF2S2-1244R | Recombinant Rhesus Macaque EIF2S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2S2-1420R | Recombinant Rhesus monkey EIF2S2 Protein, His-tagged | +Inquiry |
EIF2S2-11951Z | Recombinant Zebrafish EIF2S2 | +Inquiry |
EIF2S2-3173H | Recombinant Human EIF2S2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2S2-6665HCL | Recombinant Human EIF2S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2S2 Products
Required fields are marked with *
My Review for All EIF2S2 Products
Required fields are marked with *
0
Inquiry Basket