Recombinant Human EIF2S2 Protein, GST-tagged

Cat.No. : EIF2S2-3173H
Product Overview : Human EIF2S2 full-length ORF ( NP_003899.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Molecular Mass : 64.8 kDa
AA Sequence : MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ]
Official Symbol EIF2S2
Synonyms EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198;
Gene ID 8894
mRNA Refseq NM_003908
Protein Refseq NP_003899
MIM 603908
UniProt ID P20042

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2S2 Products

Required fields are marked with *

My Review for All EIF2S2 Products

Required fields are marked with *

0
cart-icon