Recombinant Human EIF2S2 Protein, GST-tagged
| Cat.No. : | EIF2S2-3173H |
| Product Overview : | Human EIF2S2 full-length ORF ( NP_003899.2, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
| Molecular Mass : | 64.8 kDa |
| AA Sequence : | MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ] |
| Official Symbol | EIF2S2 |
| Synonyms | EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198; |
| Gene ID | 8894 |
| mRNA Refseq | NM_003908 |
| Protein Refseq | NP_003899 |
| MIM | 603908 |
| UniProt ID | P20042 |
| ◆ Recombinant Proteins | ||
| EIF2S2-6166C | Recombinant Chicken EIF2S2 | +Inquiry |
| EIF2S2-2687H | Recombinant Human EIF2S2 protein(91-230 aa), C-His-tagged | +Inquiry |
| EIF2S2-2521H | Recombinant Human EIF2S2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EIF2S2-1244R | Recombinant Rhesus Macaque EIF2S2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Eif2s2-2776M | Recombinant Mouse Eif2s2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2S2-6665HCL | Recombinant Human EIF2S2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2S2 Products
Required fields are marked with *
My Review for All EIF2S2 Products
Required fields are marked with *
