Recombinant Human EIF4A3, His-tagged

Cat.No. : EIF4A3-27410TH
Product Overview : Recombinant fragment, corresponding to amino acids 77-411 of Human eIF4A3 with N terminal His tag; 335 amino acids, 41kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 77-411 a.a.
Description : This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.
Conjugation : HIS
Tissue specificity : Ubiquitously expressed.
Form : Lyophilised:Reconstitute with 155 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : DVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTR ELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLD YGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLN KGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCD LYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGD MPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL IINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDI RILRDIEQYYSTQIDEMPMNVADLI
Sequence Similarities : Belongs to the DEAD box helicase family. eIF4A subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name EIF4A3 eukaryotic translation initiation factor 4A3 [ Homo sapiens ]
Official Symbol EIF4A3
Synonyms EIF4A3; eukaryotic translation initiation factor 4A3; DDX48, DEAD (Asp Glu Ala Asp) box polypeptide 48 , eukaryotic translation initiation factor 4A, isoform 3; eukaryotic initiation factor 4A-III; EIF4AIII; KIAA0111;
Gene ID 9775
mRNA Refseq NM_014740
Protein Refseq NP_055555
MIM 608546
Uniprot ID P38919
Chromosome Location 17q25.3
Pathway Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem;
Function ATP binding; ATP-dependent RNA helicase activity; RNA binding; helicase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4A3 Products

Required fields are marked with *

My Review for All EIF4A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon