Recombinant Human EIF4H protein, GST-tagged
Cat.No. : | EIF4H-30161H |
Product Overview : | Recombinant Human EIF4H (1-188 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Arg188 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | EIF4H eukaryotic translation initiation factor 4H [ Homo sapiens ] |
Official Symbol | EIF4H |
Synonyms | EIF4H; eukaryotic translation initiation factor 4H; WBSCR1, Williams Beuren syndrome chromosome region 1; KIAA0038; WSCR1; Williams-Beuren syndrome chromosome region 1; WBSCR1; eIF-4H; |
Gene ID | 7458 |
mRNA Refseq | NM_022170 |
Protein Refseq | NP_071496 |
MIM | 603431 |
UniProt ID | Q15056 |
◆ Recombinant Proteins | ||
Eif4h-2790M | Recombinant Mouse Eif4h Protein, Myc/DDK-tagged | +Inquiry |
EIF4H-1725R | Recombinant Rat EIF4H Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4H-1433R | Recombinant Rhesus monkey EIF4H Protein, His-tagged | +Inquiry |
EIF4H-1257R | Recombinant Rhesus Macaque EIF4H Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4H-30161H | Recombinant Human EIF4H protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4H-6643HCL | Recombinant Human EIF4H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4H Products
Required fields are marked with *
My Review for All EIF4H Products
Required fields are marked with *
0
Inquiry Basket