Recombinant Human EIF4H protein, GST-tagged

• Cat.No.: EIF4H-30161H
• Product Overview: Recombinant Human EIF4H (1-188 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Arg188
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EIF4H eukaryotic translation initiation factor 4H [ Homo sapiens ]
• Official Symbol: EIF4H
• Synonyms: EIF4H; eukaryotic translation initiation factor 4H; WBSCR1, Williams Beuren syndrome chromosome region 1; KIAA0038; WSCR1; Williams-Beuren syndrome chromosome region 1; WBSCR1; eIF-4H
• Gene ID: 7458
• mRNA Refseq: NM_022170
• Protein Refseq: NP_071496
• MIM: 603431
• UniProt ID: Q15056