Recombinant Human EIF5B protein, His-tagged

Cat.No. : EIF5B-452H
Product Overview : Recombinant Human EIF5B protein(O60841)(629-846aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 629-846aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.3 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML
Gene Name EIF5B eukaryotic translation initiation factor 5B [ Homo sapiens ]
Official Symbol EIF5B
Synonyms EIF5B; eukaryotic translation initiation factor 5B; DKFZp434I036; FLJ10524; IF2; KIAA0741; translation initiation factor IF2; eIF-5B; translation initiation factor IF-2;
Gene ID 9669
mRNA Refseq NM_015904
Protein Refseq NP_056988
MIM 606086
UniProt ID O60841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5B Products

Required fields are marked with *

My Review for All EIF5B Products

Required fields are marked with *

0
cart-icon