Recombinant Human EIF6
Cat.No. : | EIF6-26861TH |
Product Overview : | Recombinant fragment: VLVGSYCVFS NQGGLVHPKT SIEDQDELSS LLQVPLVAGT VNRGSEVIAA GMVVNDWCAF CGLDTTSTEL SVVESVFKLN EAQPSTIATS MRDSLIDSLT of Human integrin beta 4 binding protein (amino acids 146-245) with N terminal proprietary tag, 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 146-245 aa |
Description : | Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
Sequence Similarities : | Belongs to the eIF-6 family. |
Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
Official Symbol | EIF6 |
Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; |
Gene ID | 3692 |
mRNA Refseq | NM_002212 |
Protein Refseq | NP_002203 |
MIM | 602912 |
Uniprot ID | P56537 |
Chromosome Location | 20q11.2 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem; |
Function | ribosome binding; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF6-2544C | Recombinant Chicken EIF6 | +Inquiry |
EIF6-4305HF | Recombinant Full Length Human EIF6 Protein, GST-tagged | +Inquiry |
EIF6-5119M | Recombinant Mouse EIF6 Protein | +Inquiry |
EIF6-26861TH | Recombinant Human EIF6 | +Inquiry |
EIF6-141H | Recombinant Human EIF6 protein, T7-tagged | +Inquiry |
◆ Native Proteins | ||
EIF6-2911H | Recombinant Human EIF6 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *