Recombinant Human EIF6 protein, GST-tagged
| Cat.No. : | EIF6-12391H |
| Product Overview : | Recombinant Human EIF6 protein(1-245 aa), fused with GST tag, was expressed in E.coli. |
| Availability | May 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-245 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
| Official Symbol | EIF6 |
| Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP); |
| Gene ID | 3692 |
| mRNA Refseq | NM_002212 |
| Protein Refseq | NP_002203 |
| MIM | 602912 |
| UniProt ID | P56537 |
| ◆ Recombinant Proteins | ||
| EIF6-2728M | Recombinant Mouse EIF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF6-4305HF | Recombinant Full Length Human EIF6 Protein, GST-tagged | +Inquiry |
| EIF6-2544C | Recombinant Chicken EIF6 | +Inquiry |
| EIF6-12391H | Recombinant Human EIF6 protein, GST-tagged | +Inquiry |
| EIF6-141H | Recombinant Human EIF6 protein, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *
