Recombinant Human ELAVL1(1-326aa), GST-tagged

Cat.No. : ELAVL1-01H
Product Overview : Recombinant Human ELAVL1 full-length ORF (1 a.a. - 326 a.a.) fused with GST-tag at N-terminal, was expressed in vitro Wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ELAV-like protein 1 or HuR (human antigen R) is a protein that in humans is encoded by the ELAVL1 gene. The protein encoded by this gene is a member of the ELAVL protein family. This encoded protein contains 3 RNA-binding domains and binds cis-acting AU-rich elements. It stabilizes mRNAs and thereby regulates gene expression.
Predicted MolecularMass : 62.5 kDa
AminoAcid Sequence : MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAIN TLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEA EEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPG NASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVS FKTNKSHK
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot
Stability& Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : ELAVL1
Gene Name ELAVL1 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) [ Homo sapiens ]
Synonyms ELAVL1; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R); HUR; Hua; MelG; ELAV1; ELAV-like protein 1; Hu antigen R; hu-antigen R; embryonic lethal, abnormal vision, drosophila, homolog-like 1
Gene ID 1994
mRNA Refseq NM_001419
Protein Refseq NP_001410
MIM 603466
UniProt ID Q15717
Chromosome Location 19p13.2
Pathway Gene Expression; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements; Stabilization of mRNA by HuR
Function AU-rich element binding; RNA binding; mRNA binding; nucleotide binding; protein binding; tein kinase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELAVL1 Products

Required fields are marked with *

My Review for All ELAVL1 Products

Required fields are marked with *

0
cart-icon