Recombinant Human ELAVL1(1-326aa), GST-tagged

• Cat.No.: ELAVL1-01H
• Product Overview: Recombinant Human ELAVL1 full-length ORF (1 a.a. - 326 a.a.) fused with GST-tag at N-terminal, was expressed in vitro Wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ELAV-like protein 1 or HuR (human antigen R) is a protein that in humans is encoded by the ELAVL1 gene. The protein encoded by this gene is a member of the ELAVL protein family. This encoded protein contains 3 RNA-binding domains and binds cis-acting AU-rich elements. It stabilizes mRNAs and thereby regulates gene expression.
• Predicted MolecularMass: 62.5 kDa
• AminoAcid Sequence: MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAIN TLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEA EEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPG NASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVS FKTNKSHK
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot
• Stability& Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: ELAVL1

Gene Information

• Gene Name: ELAVL1 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) [ Homo sapiens ]
• Synonyms: ELAVL1; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R); HUR; Hua; MelG; ELAV1; ELAV-like protein 1; Hu antigen R; hu-antigen R; embryonic lethal, abnormal vision, drosophila, homolog-like 1
• Gene ID: 1994
• mRNA Refseq: NM_001419
• Protein Refseq: NP_001410
• MIM: 603466
• UniProt ID: Q15717
• Chromosome Location: 19p13.2
• Pathway: Gene Expression; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements; Stabilization of mRNA by HuR
• Function: AU-rich element binding; RNA binding; mRNA binding; nucleotide binding; protein binding; tein kinase binding