Recombinant Human ELAVL1(1-326aa), GST-tagged
Cat.No. : | ELAVL1-01H |
Product Overview : | Recombinant Human ELAVL1 full-length ORF (1 a.a. - 326 a.a.) fused with GST-tag at N-terminal, was expressed in vitro Wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELAV-like protein 1 or HuR (human antigen R) is a protein that in humans is encoded by the ELAVL1 gene. The protein encoded by this gene is a member of the ELAVL protein family. This encoded protein contains 3 RNA-binding domains and binds cis-acting AU-rich elements. It stabilizes mRNAs and thereby regulates gene expression. |
Predicted MolecularMass : | 62.5 kDa |
AminoAcid Sequence : | MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAIN TLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEA EEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPG NASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVS FKTNKSHK |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot |
Stability& Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | ELAVL1 |
Gene Name | ELAVL1 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) [ Homo sapiens ] |
Synonyms | ELAVL1; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R); HUR; Hua; MelG; ELAV1; ELAV-like protein 1; Hu antigen R; hu-antigen R; embryonic lethal, abnormal vision, drosophila, homolog-like 1 |
Gene ID | 1994 |
mRNA Refseq | NM_001419 |
Protein Refseq | NP_001410 |
MIM | 603466 |
UniProt ID | Q15717 |
Chromosome Location | 19p13.2 |
Pathway | Gene Expression; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements; Stabilization of mRNA by HuR |
Function | AU-rich element binding; RNA binding; mRNA binding; nucleotide binding; protein binding; tein kinase binding |
◆ Recombinant Proteins | ||
Elavl1-1198M | Recombinant Mouse Elavl1 Protein, MYC/DDK-tagged | +Inquiry |
ELAVL1-75HFL | Active Recombinant Full Length Human ELAVL1 Protein, C-Flag-tagged | +Inquiry |
ELAVL1-5123M | Recombinant Mouse ELAVL1 Protein | +Inquiry |
ELAVL1-76HFL | Recombinant Full Length Human ELAVL1 Protein, GST-tagged | +Inquiry |
ELAVL1-01H | Recombinant Human ELAVL1(1-326aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL1-6637HCL | Recombinant Human ELAVL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELAVL1 Products
Required fields are marked with *
My Review for All ELAVL1 Products
Required fields are marked with *
0
Inquiry Basket