Recombinant Human ELF4 Protein, GST-tagged
Cat.No. : | ELF4-3242H |
Product Overview : | Human ELF4 partial ORF ( NP_001412, 521 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010] |
Molecular Mass : | 35.86 kDa |
AA Sequence : | IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELF4 E74-like factor 4 (ets domain transcription factor) [ Homo sapiens ] |
Official Symbol | ELF4 |
Synonyms | ELF4; E74-like factor 4 (ets domain transcription factor); ETS-related transcription factor Elf-4; ELFR; MEF; myeloid Elf-1-like factor; |
Gene ID | 2000 |
mRNA Refseq | NM_001127197 |
Protein Refseq | NP_001120669 |
MIM | 300775 |
UniProt ID | Q99607 |
◆ Recombinant Proteins | ||
ELF4-2984H | Recombinant Human ELF4 protein, His-tagged | +Inquiry |
ELF4-5130M | Recombinant Mouse ELF4 Protein | +Inquiry |
ELF4-2735M | Recombinant Mouse ELF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELF4-12401H | Recombinant Human ELF4, His-tagged | +Inquiry |
ELF4-3242H | Recombinant Human ELF4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF4-6631HCL | Recombinant Human ELF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF4 Products
Required fields are marked with *
My Review for All ELF4 Products
Required fields are marked with *