Recombinant Human ELF4 Protein, GST-tagged

Cat.No. : ELF4-3242H
Product Overview : Human ELF4 partial ORF ( NP_001412, 521 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010]
Molecular Mass : 35.86 kDa
AA Sequence : IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELF4 E74-like factor 4 (ets domain transcription factor) [ Homo sapiens ]
Official Symbol ELF4
Synonyms ELF4; E74-like factor 4 (ets domain transcription factor); ETS-related transcription factor Elf-4; ELFR; MEF; myeloid Elf-1-like factor;
Gene ID 2000
mRNA Refseq NM_001127197
Protein Refseq NP_001120669
MIM 300775
UniProt ID Q99607

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELF4 Products

Required fields are marked with *

My Review for All ELF4 Products

Required fields are marked with *

0
cart-icon