Recombinant Human ELF4 protein, His-tagged
Cat.No. : | ELF4-2984H |
Product Overview : | Recombinant Human ELF4 protein(301 - 515 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301 - 515 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ELF4 E74-like factor 4 (ets domain transcription factor) [ Homo sapiens ] |
Official Symbol | ELF4 |
Synonyms | ELF4; E74-like factor 4 (ets domain transcription factor); ETS-related transcription factor Elf-4; ELFR; MEF; myeloid Elf-1-like factor; |
Gene ID | 2000 |
mRNA Refseq | NM_001127197 |
Protein Refseq | NP_001120669 |
MIM | 300775 |
UniProt ID | Q99607 |
◆ Recombinant Proteins | ||
ELF4-12401H | Recombinant Human ELF4, His-tagged | +Inquiry |
ELF4-5130M | Recombinant Mouse ELF4 Protein | +Inquiry |
ELF4-3242H | Recombinant Human ELF4 Protein, GST-tagged | +Inquiry |
ELF4-2984H | Recombinant Human ELF4 protein, His-tagged | +Inquiry |
ELF4-2735M | Recombinant Mouse ELF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF4-6631HCL | Recombinant Human ELF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF4 Products
Required fields are marked with *
My Review for All ELF4 Products
Required fields are marked with *