Recombinant Human ELOF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ELOF1-1898H |
Product Overview : | ELOF1 MS Standard C13 and N15-labeled recombinant protein (NP_115753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions. |
Molecular Mass : | 9.3 kDa |
AA Sequence : | MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ELOF1 elongation factor 1 homolog [ Homo sapiens (human) ] |
Official Symbol | ELOF1 |
Synonyms | ELOF1; elongation factor 1 homolog; ELF1; transcription elongation factor 1 homolog; ELF1 homolog, elongation factor 1; elongation factor 1 homolog (ELF1, S. cerevisiae) |
Gene ID | 84337 |
mRNA Refseq | NM_032377 |
Protein Refseq | NP_115753 |
UniProt ID | P60002 |
◆ Recombinant Proteins | ||
ELOF1-1274R | Recombinant Rhesus Macaque ELOF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOF1-1898H | Recombinant Human ELOF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELOF1-4365HF | Recombinant Full Length Human ELOF1 Protein, GST-tagged | +Inquiry |
ELOF1-5146M | Recombinant Mouse ELOF1 Protein | +Inquiry |
ELOF1-1450R | Recombinant Rhesus monkey ELOF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELOF1-6617HCL | Recombinant Human ELOF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOF1 Products
Required fields are marked with *
My Review for All ELOF1 Products
Required fields are marked with *