Recombinant Human ELOVL5 protein, His-tagged

• Cat.No.: ELOVL5-7777H
• Product Overview: Recombinant Human ELOVL5 protein(30-104 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 30-104 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: CTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ELOVL5 ELOVL fatty acid elongase 5 [ Homo sapiens ]
• Official Symbol: ELOVL5
• Synonyms: ELOVL5; ELOVL fatty acid elongase 5; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3 like, yeast); elongation of very long chain fatty acids protein 5; dJ483K16.1; HELO1; ELOVL FA elongase 5; fatty acid elongase 1; 3-keto acyl-CoA synthase ELOVL5; homolog of yeast long chain polyunsaturated fatty acid elongatio; homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); RP3-483K16.1
• Gene ID: 60481
• mRNA Refseq: NM_001242828
• Protein Refseq: NP_001229757
• MIM: 611805
• UniProt ID: Q9NYP7