Recombinant Human ENAH protein, His-tagged
| Cat.No. : | ENAH-3031H |
| Product Overview : | Recombinant Human ENAH protein(501-577 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 501-577 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ENAH enabled homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ENAH |
| Synonyms | ENAH; enabled homolog (Drosophila); protein enabled homolog; FLJ10773; MENA; NDPP1; ENA; |
| Gene ID | 55740 |
| mRNA Refseq | NM_001008493 |
| Protein Refseq | NP_001008493 |
| MIM | 609061 |
| UniProt ID | Q8N8S7 |
| ◆ Recombinant Proteins | ||
| ENAH-840H | Recombinant Human ENAH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENAH-1505H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ENAH-4288HF | Recombinant Full Length Human ENAH Protein, GST-tagged | +Inquiry |
| ENAH-1818H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Enah-2819M | Recombinant Mouse Enah Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAH Products
Required fields are marked with *
My Review for All ENAH Products
Required fields are marked with *
