"ENG" Related Products

Expand
Expand

Recombinant Human ENG Protein, Trx-6His-tagged

Cat.No. : ENG-783H
Product Overview : Recombinant Human ENG, transcript variant 2, fused with Trx-6His tag at N-terminal was expressed in E. coli.
Description : This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source : E. coli
Species : Human
Tag : Trx-6His
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
Molecular Mass : 33.6kD
AA Sequence : MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAY
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : ENG endoglin [ Homo sapiens ]
Official Symbol : ENG
Synonyms : ENG; endoglin; ORW, ORW1, Osler Rendu Weber syndrome 1; CD105; END; HHT1; CD105 antigen; ORW; ORW1; FLJ41744;
Gene ID : 2022
mRNA Refseq : NM_000118
Protein Refseq : NP_000109
MIM : 131195
UniProt ID : P17813

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.