Recombinant Human ENOPH1 protein, GST-tagged
| Cat.No. : | ENOPH1-84332H |
| Product Overview : | Recombinant Human ENOPH1 protein(1-261 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-261 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | ENOPH1 |
| Synonyms | ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA; MASA homolog; 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; MST145; FLJ12594; DKFZp586M0524; |
| Gene ID | 58478 |
| mRNA Refseq | NM_021204 |
| Protein Refseq | NP_067027 |
| UniProt ID | Q9UHY7 |
| ◆ Recombinant Proteins | ||
| ENOPH1-2854H | Recombinant Human ENOPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENOPH1-5207M | Recombinant Mouse ENOPH1 Protein | +Inquiry |
| ENOPH1-5490H | Recombinant Human ENOPH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ENOPH1-1758R | Recombinant Rat ENOPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENOPH1-3457H | Recombinant Human ENOPH1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENOPH1-6597HCL | Recombinant Human ENOPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENOPH1 Products
Required fields are marked with *
My Review for All ENOPH1 Products
Required fields are marked with *
