Recombinant Human ENTPD3 protein, His-tagged
| Cat.No. : | ENTPD3-12468H |
| Product Overview : | Recombinant Human ENTPD3 protein(45-366 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 45-366 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | IHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGP |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens ] |
| Official Symbol | ENTPD3 |
| Synonyms | ENTPD3; ectonucleoside triphosphate diphosphohydrolase 3; CD39L3; HB6; NTPDase 3; CD39-like 3; ecto-ATPase 3; ecto-ATPDase 3; ecto-apyrase 3; CD39 antigen-like 3; ecto-ATP diphosphohydrolase 3; NTPDase-3; FLJ93839; |
| Gene ID | 956 |
| mRNA Refseq | NM_001248 |
| Protein Refseq | NP_001239 |
| MIM | 603161 |
| UniProt ID | O75355 |
| ◆ Recombinant Proteins | ||
| ENTPD3-2861H | Recombinant Human ENTPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENTPD3-2860H | Recombinant Human ENTPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENTPD3-1033H | Active Recombinant Human ENTPD3 Protein, His-tagged | +Inquiry |
| ENTPD3-208H | Active Recombinant Human ENTPD3, His-tagged | +Inquiry |
| ENTPD3-12468H | Recombinant Human ENTPD3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENTPD3-475HCL | Recombinant Human ENTPD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENTPD3 Products
Required fields are marked with *
My Review for All ENTPD3 Products
Required fields are marked with *
