Recombinant Human EPB41L3, His-tagged
| Cat.No. : | EPB41L3-28576TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 949-1087 of Human EPB41L3 with N terminal His tag; Predicted MWt 16 kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 949-1087 a.a. | 
| Description : | Band 4.1-like protein 3 is a protein that in humans is encoded by the EPB41L3 gene. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 126 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | STVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYE SSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTV KGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQH PDMSVTKVVVHKETEITPEDGED | 
| Gene Name | EPB41L3 erythrocyte membrane protein band 4.1-like 3 [ Homo sapiens ] | 
| Official Symbol | EPB41L3 | 
| Synonyms | EPB41L3; erythrocyte membrane protein band 4.1-like 3; band 4.1-like protein 3; 4.1B; DAL1; KIAA0987; | 
| Gene ID | 23136 | 
| mRNA Refseq | NM_012307 | 
| Protein Refseq | NP_036439 | 
| MIM | 605331 | 
| Uniprot ID | Q9Y2J2 | 
| Chromosome Location | 18p11.32 | 
| Pathway | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; | 
| Function | actin binding; protein binding; structural molecule activity; | 
| ◆ Recombinant Proteins | ||
| EPB41L3-30139H | Recombinant Human EPB41L3 protein, GST-tagged | +Inquiry | 
| EPB41L3-28576TH | Recombinant Human EPB41L3, His-tagged | +Inquiry | 
| EPB41L3-12479H | Recombinant Human EPB41L3, GST-tagged | +Inquiry | 
| EPB41L3-4259HF | Recombinant Full Length Human EPB41L3 Protein, GST-tagged | +Inquiry | 
| EPB41L3-3356H | Recombinant Human EPB41L3 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EPB41L3-562HCL | Recombinant Human EPB41L3 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EPB41L3 Products
Required fields are marked with *
My Review for All EPB41L3 Products
Required fields are marked with *
  
        
    
      
            