Recombinant Human EPB41L3, His-tagged
Cat.No. : | EPB41L3-28576TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 949-1087 of Human EPB41L3 with N terminal His tag; Predicted MWt 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 949-1087 a.a. |
Description : | Band 4.1-like protein 3 is a protein that in humans is encoded by the EPB41L3 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | STVKTETISFGSVSPGGVKLEISTKEVPVVHTETKTITYE SSQVDPGTDLEPGVLMSAQTITSETTSTTTTTHITKTV KGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQH PDMSVTKVVVHKETEITPEDGED |
Gene Name | EPB41L3 erythrocyte membrane protein band 4.1-like 3 [ Homo sapiens ] |
Official Symbol | EPB41L3 |
Synonyms | EPB41L3; erythrocyte membrane protein band 4.1-like 3; band 4.1-like protein 3; 4.1B; DAL1; KIAA0987; |
Gene ID | 23136 |
mRNA Refseq | NM_012307 |
Protein Refseq | NP_036439 |
MIM | 605331 |
Uniprot ID | Q9Y2J2 |
Chromosome Location | 18p11.32 |
Pathway | Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
Function | actin binding; protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
EPB41L3-4259HF | Recombinant Full Length Human EPB41L3 Protein, GST-tagged | +Inquiry |
EPB41L3-12479H | Recombinant Human EPB41L3, GST-tagged | +Inquiry |
EPB41L3-3356H | Recombinant Human EPB41L3 Protein, GST-tagged | +Inquiry |
EPB41L3-30139H | Recombinant Human EPB41L3 protein, GST-tagged | +Inquiry |
EPB41L3-28576TH | Recombinant Human EPB41L3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPB41L3-562HCL | Recombinant Human EPB41L3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPB41L3 Products
Required fields are marked with *
My Review for All EPB41L3 Products
Required fields are marked with *