Recombinant Human EPB41L3 protein, GST-tagged

Cat.No. : EPB41L3-30139H
Product Overview : Recombinant Human EPB41L3 protein(191-312 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 191-312 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name EPB41L3 erythrocyte membrane protein band 4.1-like 3 [ Homo sapiens ]
Official Symbol EPB41L3
Synonyms EPB41L3; erythrocyte membrane protein band 4.1-like 3; band 4.1-like protein 3; 4.1B; DAL1; KIAA0987; differentially expressed in adenocarcinoma of the lung protein 1; DAL-1; FLJ37633;
Gene ID 23136
mRNA Refseq NM_012307
Protein Refseq NP_036439
MIM 605331
UniProt ID Q9Y2J2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EPB41L3 Products

Required fields are marked with *

My Review for All EPB41L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon