Recombinant Human EPB41L3 protein, GST-tagged
Cat.No. : | EPB41L3-30139H |
Product Overview : | Recombinant Human EPB41L3 protein(191-312 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 191-312 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | EPB41L3 erythrocyte membrane protein band 4.1-like 3 [ Homo sapiens ] |
Official Symbol | EPB41L3 |
Synonyms | EPB41L3; erythrocyte membrane protein band 4.1-like 3; band 4.1-like protein 3; 4.1B; DAL1; KIAA0987; differentially expressed in adenocarcinoma of the lung protein 1; DAL-1; FLJ37633; |
Gene ID | 23136 |
mRNA Refseq | NM_012307 |
Protein Refseq | NP_036439 |
MIM | 605331 |
UniProt ID | Q9Y2J2 |
◆ Recombinant Proteins | ||
EPB41L3-12479H | Recombinant Human EPB41L3, GST-tagged | +Inquiry |
EPB41L3-3356H | Recombinant Human EPB41L3 Protein, GST-tagged | +Inquiry |
EPB41L3-28576TH | Recombinant Human EPB41L3, His-tagged | +Inquiry |
EPB41L3-4259HF | Recombinant Full Length Human EPB41L3 Protein, GST-tagged | +Inquiry |
EPB41L3-30139H | Recombinant Human EPB41L3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPB41L3-562HCL | Recombinant Human EPB41L3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPB41L3 Products
Required fields are marked with *
My Review for All EPB41L3 Products
Required fields are marked with *
0
Inquiry Basket