Recombinant Human EPOR protein(25-250aa), His-tagged
Cat.No. : | EPOR-3851H |
Product Overview : | Recombinant Human EPOR protein(P19235)(25-250aa), fused with C-terminal His tag, was expressed in HEK293. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-250 a.a. |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP |
Gene Name | EPOR erythropoietin receptor [ Homo sapiens ] |
Official Symbol | EPOR |
Synonyms | EPOR; erythropoietin receptor; EPO-R; MGC138358; |
Gene ID | 2057 |
mRNA Refseq | NM_000121 |
Protein Refseq | NP_000112 |
MIM | 133171 |
UniProt ID | P19235 |
◆ Recombinant Proteins | ||
Epor-654R | Recombinant Rat Epor protein, His-tagged | +Inquiry |
EPOR-3851H | Recombinant Human EPOR protein(25-250aa), His-tagged | +Inquiry |
Epor-4240R | Recombinant Rat Epor protein, His-SUMO&His-tagged | +Inquiry |
Epor-2864R | Recombinant Rat Epor protein, His-tagged | +Inquiry |
EPOR-2296H | Recombinant Human EPOR Protein (Ala25-Pro250), N-His tagged | +Inquiry |
◆ Native Proteins | ||
EPOR-66H | Active Recombinant Human EPOR Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPOR-2055HCL | Recombinant Human EPOR cell lysate | +Inquiry |
EPOR-2582MCL | Recombinant Mouse EPOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPOR Products
Required fields are marked with *
My Review for All EPOR Products
Required fields are marked with *
0
Inquiry Basket