Recombinant Human EPRS protein, His-tagged
Cat.No. : | EPRS-3461H |
Product Overview : | Recombinant Human EPRS protein(1163-1512 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1163-1512 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EPRS glutamyl-prolyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | EPRS |
Synonyms | EPRS; glutamyl-prolyl-tRNA synthetase; QARS, QPRS; bifunctional glutamate/proline--tRNA ligase; EARS; GLUPRORS; glutamate tRNA ligase; PARS; proline tRNA ligase; proline-tRNA ligase; prolyl-tRNA synthetase; glutaminyl-tRNA synthetase; proliferation-inducing protein 32; bifunctional aminoacyl-tRNA synthetase; proliferation-inducing gene 32 protein; cell proliferation-inducing gene 32 protein; QARS; QPRS; PIG32; DKFZp313B047; |
Gene ID | 2058 |
mRNA Refseq | NM_004446 |
Protein Refseq | NP_004437 |
MIM | 138295 |
UniProt ID | P07814 |
◆ Recombinant Proteins | ||
EPRS-2208H | Recombinant Human EPRS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EPRS-12504H | Recombinant Human EPRS, GST-tagged | +Inquiry |
EPRS-3461H | Recombinant Human EPRS protein, His-tagged | +Inquiry |
Eprs-331M | Recombinant Mouse Eprs Protein, MYC/DDK-tagged | +Inquiry |
EPRS-2826M | Recombinant Mouse EPRS Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPRS Products
Required fields are marked with *
My Review for All EPRS Products
Required fields are marked with *
0
Inquiry Basket