Recombinant Human EPRS protein, His-tagged

• Cat.No.: EPRS-3461H
• Product Overview: Recombinant Human EPRS protein(1163-1512 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1163-1512 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EPRS glutamyl-prolyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: EPRS
• Synonyms: EPRS; glutamyl-prolyl-tRNA synthetase; QARS, QPRS; bifunctional glutamate/proline--tRNA ligase; EARS; GLUPRORS; glutamate tRNA ligase; PARS; proline tRNA ligase; proline-tRNA ligase; prolyl-tRNA synthetase; glutaminyl-tRNA synthetase; proliferation-inducing protein 32; bifunctional aminoacyl-tRNA synthetase; proliferation-inducing gene 32 protein; cell proliferation-inducing gene 32 protein; QARS; QPRS; PIG32; DKFZp313B047
• Gene ID: 2058
• mRNA Refseq: NM_004446
• Protein Refseq: NP_004437
• MIM: 138295
• UniProt ID: P07814