Recombinant Human ERAS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ERAS-1972H |
Product Overview : | ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ERAS ES cell expressed Ras [ Homo sapiens (human) ] |
Official Symbol | ERAS |
Synonyms | ERAS; ES cell expressed Ras; HRAS2, HRASP, v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; E-Ras; small GTPase protein E-Ras; embryonic stem cell-expressed Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; HRAS2; HRASP; MGC126691; MGC126693; |
Gene ID | 3266 |
mRNA Refseq | NM_181532 |
Protein Refseq | NP_853510 |
MIM | 300437 |
UniProt ID | Q7Z444 |
◆ Recombinant Proteins | ||
ERAS-3440H | Recombinant Human ERAS Protein, GST-tagged | +Inquiry |
ERAS-1490R | Recombinant Rhesus monkey ERAS Protein, His-tagged | +Inquiry |
ERAS-1261H | Recombinant Human ERAS Protein (3-230 aa), His-tagged | +Inquiry |
ERAS-716HFL | Recombinant Full Length Human ERAS Protein, C-Flag-tagged | +Inquiry |
ERAS-4357HF | Recombinant Full Length Human ERAS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERAS-6570HCL | Recombinant Human ERAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAS Products
Required fields are marked with *
My Review for All ERAS Products
Required fields are marked with *