Recombinant Human ERAS Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ERAS-1972H
Product Overview : ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance.
Molecular Mass : 25.3 kDa
AA Sequence : MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ERAS ES cell expressed Ras [ Homo sapiens (human) ]
Official Symbol ERAS
Synonyms ERAS; ES cell expressed Ras; HRAS2, HRASP, v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; E-Ras; small GTPase protein E-Ras; embryonic stem cell-expressed Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; HRAS2; HRASP; MGC126691; MGC126693;
Gene ID 3266
mRNA Refseq NM_181532
Protein Refseq NP_853510
MIM 300437
UniProt ID Q7Z444

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERAS Products

Required fields are marked with *

My Review for All ERAS Products

Required fields are marked with *

0
cart-icon
0
compare icon